<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10835
| Description |
Uncharacterized protein |
| Sequence | MADRLTQLQDTVNMQAEHFCNAIGIIQQTSYPSKFPNFDRTGSQTPIQNLQQEDYAQLFAQLISRCAKDIDTLIESLPNDDSSAEIQNQSLKRLEVENQEAAERLEEIVDKGEMLLQKIQLALEDIAQAQLDMQISMKDNNTK |
| Length | 143 |
| Position | Middle |
| Organism | Stomoxys calcitrans (Stable fly) (Conops calcitrans) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea>
Muscidae> Stomoxys.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.604 |
| Instability index | 39.60 |
| Isoelectric point | 4.34 |
| Molecular weight | 16259.01 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10835
No repeats found
|