<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10833
Description |
Uncharacterized protein |
Sequence | LTNTYIHVSLLSRFIDNLFNSDITHTNTTYKVCRPFSSNAVVIATISHVLKAAIICKGVLIEWVTVKGYDEPMEIEDLWTESRYEVFRKVQEHTHSAMLHFFSPTLPELAVKSYMTWLNSYSKLFLEPCKRCGKYVSNGLPPTWRDLRTLEPFHEECKNC |
Length | 160 |
Position | Tail |
Organism | Stomoxys calcitrans (Stable fly) (Conops calcitrans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea>
Muscidae> Stomoxys.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.160 |
Instability index | 37.39 |
Isoelectric point | 7.18 |
Molecular weight | 18593.22 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP10833
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.86| 16| 25| 116| 132| 1
---------------------------------------------------------------------------
116- 132 (29.64/22.30) TWlNSYSKL..FLEPCKRC
143- 160 (29.23/17.28) TW.RDLRTLepFHEECKNC
---------------------------------------------------------------------------
|