<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10830
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MNPLEKIHVLDDIEKEIILCLQSAGQALQELSKEKSSQKNAETQTAQFLKSLQNVEMKLSEQINYLTQVSTGQPHEGSGYASAKVLQMAWHRISHVRSRVRELEETKAKYTHAARQQQQQRQQQHAAAAALQQQQQQQQMVQQQTLQQDPNIGGSNANPSGGLMSQDVNMNQGGGN |
Length | 176 |
Position | Head |
Organism | Stomoxys calcitrans (Stable fly) (Conops calcitrans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea>
Muscidae> Stomoxys.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.905 |
Instability index | 70.98 |
Isoelectric point | 7.02 |
Molecular weight | 19642.64 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10830
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.36| 11| 15| 113| 123| 1
---------------------------------------------------------------------------
113- 123 (21.85/ 8.48) AARQQQQQRQQ
129- 139 (21.51/ 8.26) AALQQQQQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.56| 11| 17| 146| 156| 2
---------------------------------------------------------------------------
146- 156 (21.88/14.79) LQQDPNI..GGSN
164- 176 (17.68/10.73) MSQDVNMnqGGGN
---------------------------------------------------------------------------
|