<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10818
| Description |
Uncharacterized protein |
| Sequence | MASSSNVNGNLMDEFEEAFQNCLLSLTKLEANTGTNKEEVELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPDQLIKDENQDLRIEIQRKETLLNKHYSRLEEWKGCLSDIQQNPAILNRPVGPGGIAAGLGDVAAGGLPGPSGSSGPMGGMGGPQQRPGMIPNMPGGAMGQLGQMNQGGPQQHLQNQKMLQAQQMQLRMMGKLPK |
| Length | 208 |
| Position | Head |
| Organism | Stomoxys calcitrans (Stable fly) (Conops calcitrans) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea>
Muscidae> Stomoxys.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.568 |
| Instability index | 47.12 |
| Isoelectric point | 6.75 |
| Molecular weight | 22731.80 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10818
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 105.44| 22| 23| 139| 160| 1
---------------------------------------------------------------------------
118- 135 (24.57/ 8.38) AILNR.PVGPGGIAAGL..GD....
139- 160 (45.43/21.06) GGLPG.PSGSSGPMGGM..GGPQQR
162- 186 (35.44/14.99) GMIPNmPGGAMGQLGQMnqGGPQQH
---------------------------------------------------------------------------
|