<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10815
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSFHLSTKERLLLLIDDMELISKELIDNLMPKHQIIKSSTAEHTHTALVDLLVAKDEEFRKMLELADEQAKLEQKMDELKAKVDVQDREIQKLQKSLKEAEQILATAIFQARQKLASIHQANKRPVSSEELIKYAHRISSANAVSAPITWCIGDVRRPYPTDIEMRNGFLGKSDLNINGGGVVHQNNLTDNQRSVNEVPNAFQNQFNWTNMGELHMTMGTSGNSVALETRSHKETSQDDVEVMSTDSSSSSSSDSQ |
Length | 256 |
Position | Middle |
Organism | Stomoxys calcitrans (Stable fly) (Conops calcitrans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea>
Muscidae> Stomoxys.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.574 |
Instability index | 45.76 |
Isoelectric point | 5.50 |
Molecular weight | 28760.05 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10815
No repeats found
|