<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10814
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMNNYSNMMMGEQFRKMDSNYSPKSSPHGGRSPVVSRQDSSGTLKATISLGKTPTIIQTGPFYSMKEPPGKGELTGDKDLMTEYGLHHTLTKFKDKKVKESLSSFLPNLPGIYDGMNNLENSTLRSVIDKPPIGGKELLPLSSVQLAGFRLHPGPLPEQYRAFNTIPARKHKNKHKKHKHKDGQQPPETNLMDSSGLETYEKKHKKQKRHEDEKERKKRKKEKKRKKKSHSPEPPSSGGVSPMLGGPSQQGGMMGMSMQGGSMGSLQGLTTGPNNPLGPGSGVTNMSGPGGMMMPQHASLF |
| Length | 301 |
| Position | Head |
| Organism | Stomoxys calcitrans (Stable fly) (Conops calcitrans) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea>
Muscidae> Stomoxys.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.997 |
| Instability index | 56.41 |
| Isoelectric point | 9.94 |
| Molecular weight | 33006.50 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10814
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 70.57| 13| 20| 201| 213| 1
---------------------------------------------------------------------------
172- 183 (23.19/ 9.12) KNKHKKHK.HKDG
201- 213 (25.31/10.45) EKKHKKQKRHEDE
222- 233 (22.07/ 8.42) EKKRKK.KSHSPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.50| 13| 45| 235| 247| 2
---------------------------------------------------------------------------
235- 247 (26.06/10.78) PSSGGVSPMLGGP
261- 273 (23.01/ 8.76) GSMGSLQGLTTGP
279- 289 (22.43/ 8.37) PGS.GVTNM.SGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.24| 14| 14| 65| 78| 3
---------------------------------------------------------------------------
60- 75 (22.54/11.73) GPFysMKEPPGKGELT
76- 91 (21.70/11.00) GDKdlMTEYGLHHTLT
---------------------------------------------------------------------------
|