Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MMNNYSNMMMGEQFRKMDSNYSPKSSPHGGRSPVVSRQDSSGTLKATISLGKTPTIIQTGPFYSMKEPPGKGELTGDKDLMTEYGLHHTLTKFKDKKVKESLSSFLPNLPGIYDGMNNLENSTLRSVIDKPPIGGKELLPLSSVQLAGFRLHPGPLPEQYRAFNTIPARKHKNKHKKHKHKDGQQPPETNLMDSSGLETYEKKHKKQKRHEDEKERKKRKKEKKRKKKSHSPEPPSSGGVSPMLGGPSQQGGMMGMSMQGGSMGSLQGLTTGPNNPLGPGSGVTNMSGPGGMMMPQHASLF |
Length | 301 |
Position | Head |
Organism | Stomoxys calcitrans (Stable fly) (Conops calcitrans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea> Muscidae> Stomoxys. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.997 |
Instability index | 56.41 |
Isoelectric point | 9.94 |
Molecular weight | 33006.50 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10814 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 70.57| 13| 20| 201| 213| 1 --------------------------------------------------------------------------- 172- 183 (23.19/ 9.12) KNKHKKHK.HKDG 201- 213 (25.31/10.45) EKKHKKQKRHEDE 222- 233 (22.07/ 8.42) EKKRKK.KSHSPE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 71.50| 13| 45| 235| 247| 2 --------------------------------------------------------------------------- 235- 247 (26.06/10.78) PSSGGVSPMLGGP 261- 273 (23.01/ 8.76) GSMGSLQGLTTGP 279- 289 (22.43/ 8.37) PGS.GVTNM.SGP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.24| 14| 14| 65| 78| 3 --------------------------------------------------------------------------- 60- 75 (22.54/11.73) GPFysMKEPPGKGELT 76- 91 (21.70/11.00) GDKdlMTEYGLHHTLT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKRKKKSH 2) YRAFNTIPARKHKNKHKK | 223 160 | 230 177 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab