<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10810

Description Mediator of RNA polymerase II transcription subunit 1
SequenceMATLNIKPVVTTVGGANANLLSNLPSTAEKNKQWQRELLMERIRSHSSQHKTFQELSKGMRMGMLEKRYPLDAVEKSNLQKCLDNMQHCIKVTSRQGLVERLESLSRQLSLKFSDDTKALFISTDMFYLEILLDSNGSLTDVKVHHESKVEQQSCSELVDCLNRGDFADFTAQLEGFSSIYQLNAESKVKIKAYDAMQAMETDLYNIFQMQNFSKDAAQVLQDSAVGIVMQRRGGHPMRLVYFVSPYDLISLETKTLQPINLDTFSNKKIGFSVTVNLEASSANKLQILPTVTFSKDPQSGMDMPVFAPLTQMNSMLLPATFVLRLNKSLPVCYNTMRAMGLCPAAMGGDNTASMSSSSTLESQNKPPVIANIMSLVIQTASEQQTKTSQKGLFVCLPDQTHCYFFTENKLMKSTLIHSVPFTEPSQVHKILEFLKKMALFYSLLASCVRPQSKMGIDVDSTTVLEVNAISFQQISVALQHPYEESMATVEFDLRSGVPQCTIYSISKNYDILSIKLTSIVQKCLSIPVTIRALLKFWDQERIKKFQRNLGATTAALGGSGGGPSATSGGGNPHSSYGNFSMTGGSNDPGGGMGRMPGMGGGGSGGLPGGVPIKMETNSVGQQRLSSQMPVVGSAGFLKFKSAAGDIKQEDFHESPKSQTTTSILAADTMTASNLMQSNLEVNSLGHQQQQQQQKQLEQQIADHDIADKYKNIWKDKTTNLKNSVSITPINAESSNSTPLDVKRTGGIEIIPLTGQSNNPSVNAASNATSPINNNGSTTITITPINAGSSSLATSSSSLVNKEKKLASSSANSLGPSVGTIPSSSSSSSSSSSSSKRSLDSSEGQKDKKRKKRRDDSPMGPPEKIFSRQNSPAGSSEAAVTTVARKFSSPSSSPKGSSGGLLATSVAGSSLSARPSPKHSPVYSSPKHNTASNSPKSPFGTHSSPKHGSSGKPSMSTLKSATAASPKEKSSSSSSSMTSASVLSTAALVRSLTSSSGSSSSTSSPSTSSVNAKAAAAAAVKSSMGVTTMQQMKSVPGLSLMTAAAPSNFAGGSNSALDLNAGMRKGVAAAFDDVDTNYSNNLQISNVGSIAGVNSGGPGGLGATRQSQAAAAASSANLSPWHQ
Length1123
PositionMiddle
OrganismStomoxys calcitrans (Stable fly) (Conops calcitrans)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea> Muscidae> Stomoxys.
Aromaticity0.05
Grand average of hydropathy-0.334
Instability index56.72
Isoelectric point9.34
Molecular weight118946.86
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10810
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     115.02|      29|      30|     916|     944|       1
---------------------------------------------------------------------------
  904-  935 (41.15/11.95)	TSVAGSSLSarpSPKHSPVYSSPKHNTASNSP
  936-  966 (37.50/10.28)	KSPFGTHSSpkhGSSGKPSMSTLKSATAA.SP
  993- 1019 (36.36/ 9.76)	TSSSG..SS...SSTSSPSTSSVNAKAAAAAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.26|      21|      30|     729|     758|       2
---------------------------------------------------------------------------
  729-  750 (34.45/13.89)	P.INAeSSNST.PLDVKRTGGIEI
  760-  782 (27.81/17.37)	PsVNA.ASNATsPINNNGSTTITI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.85|      12|      30|     558|     587|       3
---------------------------------------------------------------------------
  558-  571 (22.11/13.47)	GGSGGGPSAtsGGG
  591-  602 (27.74/11.32)	GGMGRMPGM..GGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     118.02|      34|      37|     789|     822|       4
---------------------------------------------------------------------------
  789-  819 (46.05/22.80)	.......SSSLATSSS..SL....VNKEKKLASSSANS.LGP.....SVG
  820-  869 (29.85/11.64)	TIPssssSSSSSSSSSkrSLdsseGQKDKKRKKRRDDSpMGPpekifSRQ
  870-  900 (42.12/20.10)	NSP..agSSEAAVTTV..A.........RKFSSPSSSP.KGS.....SGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.81|      13|      92|     176|     192|       5
---------------------------------------------------------------------------
  176-  188 (21.96/17.79)	GFSSIYQLNAESK
  203-  215 (23.85/ 9.01)	DLYNIFQMQNFSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     201.08|      51|     262|     233|     283|       6
---------------------------------------------------------------------------
  233-  283 (83.41/62.16)	RGGHPMRLVYFVSP.YDLISLE.TKTLQ.....PIN....LDTFSNKKIGFSVTVNLEASSA
  445-  488 (57.31/40.10)	.......LASCVRP.QSKMGID.VDSTT.....VLE....VNAISFQQISVALQHPYEESMA
  495-  555 (60.37/42.69)	RSGVPQCTIYSISKnYDILSIKlTSIVQkclsiPVTiralLKFWDQERIK.KFQRNLGATTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.13|      15|      24|     304|     320|       7
---------------------------------------------------------------------------
  304-  320 (24.23/29.08)	MPVFapLTQMNSM.LLPA
  330-  345 (26.90/21.75)	LPVC..YNTMRAMgLCPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.81|      31|      56|      19|      49|       8
---------------------------------------------------------------------------
   19-   49 (53.65/42.36)	NLLSNLPSTAEKNKQWQRELLMERIRSHSSQ
   78-  108 (54.16/42.84)	NLQKCLDNMQHCIKVTSRQGLVERLESLSRQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.06|      25|      25|    1043|    1067|       9
---------------------------------------------------------------------------
 1037- 1061 (40.93/26.16)	GLSLMT.AAA....PSNFAGG...SN..SALDLNA
 1062- 1095 (25.15/12.54)	GMRKGV.AAAfddvDTNYSNNlqiSNvgSIAGVNS
 1096- 1116 (19.98/ 8.08)	GGPGGLgATR....QSQAAAA...AS..SA.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     130.76|      40|     312|     352|     393|      10
---------------------------------------------------------------------------
  352-  393 (59.48/42.81)	TASMSSSSTLESQNkpPVIANIM..SLVIQTAS...EQ....QTKTSQKGL
  625-  659 (20.60/ 7.17)	.........LSSQM..PVVGSAG..FLKFKSAAgdiKQedfhESPKSQ...
  661-  697 (50.68/29.55)	TTSILAADTMTA.......SNLMqsNLEVNSLG...HQ....QQQQQQKQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.77|      17|      26|     398|     414|      11
---------------------------------------------------------------------------
  398-  414 (33.22/19.91)	PDQTH..CYFFTENKLMKS
  425-  443 (25.55/13.85)	PSQVHkiLEFLKKMALFYS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10810 with Med1 domain of Kingdom Metazoa
Unable to open file!