Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAKMYGKGKTAIESEEQQKLRWQVELEFVQCLANPNYLNFLAQRGYFKDQAFINYLKYLQYWKEPEYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIRMLNAVNGNASSQINSTSGNNIDGMVEQQQPQPQQGGQASTNALGGNMQNGTVTSSNSQQSQIGQQQTGQQQLNGNSSNSSIVPNQSNAGAPLMQKI |
Length | 214 |
Position | Middle |
Organism | Stomoxys calcitrans (Stable fly) (Conops calcitrans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea> Muscidae> Stomoxys. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.733 |
Instability index | 53.72 |
Isoelectric point | 8.60 |
Molecular weight | 24476.20 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10808 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 143.81| 35| 36| 121| 155| 1 --------------------------------------------------------------------------- 93- 118 (29.66/11.58) ..........VNSQCCKFIDDqAILQWQH.YTRKRIR 121- 155 (61.71/31.14) NAVNGNASSQINSTSGNNIDG.MVEQQQP.QPQQGGQ 159- 193 (52.45/25.49) NALGGNMQNG.TVTSSNSQQS.QIGQQQTgQQQLNGN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 95.57| 26| 38| 22| 48| 2 --------------------------------------------------------------------------- 22- 48 (46.18/36.59) WQvELEFVQCLANPNYLNFLA..QRGYFK 62- 89 (49.40/34.35) WK.EPEYAKYLMYPMCLYFLDllQYEHFR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IGQQQTG 2) IVPNQSNAGAPLMQKI | 180 199 | 186 214 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab