Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MMNNYSNMMMGGEQFRKMDSNYSPKSSPHGGRSPVVSRQDSSGTLKATISLGKTPTIIQTGPFYSMKEPPGKGELTGDKDLMTEYGLHHTLTKFKDKKVKESLSSFLPNLPGIYDGMNNLENSTLRSVIDKPPIGGKELLPLTSVQLAGFRLHPGPLPEQYRAFNTIPARKHKNKHKKHKHKDGQQPPETNLMDSSGLETYEKKHKKQKRHEDEKERKKRKKEKKRKKKSHSPEPPSSGGVSPMLGGGSQIPGVGGMMMGGPSSMSAMQGGAVGMGSSLQGLATGPNNPLGPGSGVTNMSGPGGMMMPQHASLF |
Length | 314 |
Position | Head |
Organism | Musca domestica (House fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea> Muscidae> Musca. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.895 |
Instability index | 54.67 |
Isoelectric point | 9.94 |
Molecular weight | 34003.67 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10796 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 96.92| 26| 45| 239| 265| 1 --------------------------------------------------------------------------- 239- 265 (48.53/20.86) GGVSPmLGGGS...QIPGVGGMMMGGPSSM 285- 313 (48.38/17.33) GPNNP.LGPGSgvtNMSGPGGMMMPQHASL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.92| 17| 18| 4| 20| 2 --------------------------------------------------------------------------- 1- 17 (33.21/17.03) MMNNYS..NMMMGGEQ..FRK 18- 38 (22.71/ 9.56) MDSNYSpkSSPHGGRSpvVSR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 70.57| 13| 18| 202| 214| 3 --------------------------------------------------------------------------- 173- 184 (23.19/12.27) KNKHKKHK.HKDG 202- 214 (25.31/13.98) EKKHKKQKRHEDE 223- 234 (22.07/11.36) EKKRKK.KSHSPE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 32.71| 10| 21| 103| 112| 4 --------------------------------------------------------------------------- 87- 96 (15.21/ 6.88) LHHTLTKFKD 103- 112 (17.50/ 8.94) LSSFLPNLPG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ARKHKNKHKK 2) KKRKKKSH 3) YRAFNTI | 169 224 161 | 178 231 167 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab