Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MNSYAATESEEQQKLRWQVELEFVQCLANPNYLNFLAQRGYFKDQAFINYLKYLQYWKEPEYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKMLNAVNGNVNSQLNSTTGSNLDLMDGTQQQSGQLTGQQQATQQQGAQATNALGGSVAGNMQNGTVSSVGGGGGGGTTPQNQMVGQPGQQSQQQQLNGNSSNSSIVPNQSNTGAAMMQKI |
Length | 232 |
Position | Middle |
Organism | Musca domestica (House fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea> Muscidae> Musca. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.669 |
Instability index | 45.88 |
Isoelectric point | 6.72 |
Molecular weight | 25941.61 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10791 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 127.35| 39| 48| 116| 163| 1 --------------------------------------------------------------------------- 116- 157 (59.78/37.40) NAVNGNVNSQLNSTTGSNLDlmDGTQQQSgQLTGQ..QQATQQQ 167- 207 (67.56/24.88) GSVAGNMQNGTVSSVGGGGG..GGTTPQN.QMVGQpgQQSQQQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 91.78| 21| 21| 66| 86| 2 --------------------------------------------------------------------------- 51- 71 (38.30/25.97) LKYLQ...YWKEPEYAKYLMYPMC 72- 92 (36.45/24.40) LYFLD...LLQYEHFRREIVNSQC 93- 110 (17.04/ 7.94) CKFIDdqaILQWQHYTRK...... --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QNQMVGQ 2) SNTGAAMMQKI | 192 222 | 198 232 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab