<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10790
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAKMYGKGKTATESEEQQKLRWQVELEFVQCLANPNYLNFLAQRGYFKDQAFINYLKYLQYWKEPEYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKMLNAVNGNVNSQLNSTTGSNLDLMDGTQQQSGQLTGQQQATQQQGAQATNALGGSVAGNMQNGTVSSVGGGGGGGTTPQNQMVGQPGQQSQQQQLNGNSSNSSIVPNQSNTGAAMMQKI |
| Length | 237 |
| Position | Middle |
| Organism | Musca domestica (House fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea>
Muscidae> Musca.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.684 |
| Instability index | 45.58 |
| Isoelectric point | 8.59 |
| Molecular weight | 26471.35 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10790
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 127.35| 39| 48| 121| 168| 1
---------------------------------------------------------------------------
121- 162 (59.78/36.12) NAVNGNVNSQLNSTTGSNLDlmDGTQQQSgQLTGQ..QQATQQQ
172- 212 (67.56/23.93) GSVAGNMQNGTVSSVGGGGG..GGTTPQN.QMVGQpgQQSQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.78| 21| 21| 71| 91| 2
---------------------------------------------------------------------------
56- 76 (38.30/25.52) LKYLQ...YWKEPEYAKYLMYPMC
77- 97 (36.45/23.98) LYFLD...LLQYEHFRREIVNSQC
98- 115 (17.04/ 7.92) CKFIDdqaILQWQHYTRK......
---------------------------------------------------------------------------
|