<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10779
| Description |
Uncharacterized protein |
| Sequence | MTHQSHQTNGASLEDCHTNFFALTDLCGIKWRKFVNSERPNASSDPLDDPILRSYSRCMQADILCVWRRVQSTRQDNSDPNAIFEVVNTSKVHPPLSLAAAKELWLFWYGEEPDLTDLVDAELLKVAGKYM |
| Length | 131 |
| Position | Middle |
| Organism | Musca domestica (House fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea>
Muscidae> Musca.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.414 |
| Instability index | 40.04 |
| Isoelectric point | 5.25 |
| Molecular weight | 14928.67 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10779
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.05| 20| 35| 26| 47| 1
---------------------------------------------------------------------------
26- 47 (32.46/25.63) LCGikWRKFVNSERPNASSDPL
64- 83 (36.59/22.62) LCV..WRRVQSTRQDNSDPNAI
---------------------------------------------------------------------------
|