<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10774

Description Uncharacterized protein
SequenceMAEQQHSTDLLGVPCKDEYSGSTMMDQDTSSIDNRGEGQKHYSRCSSAGSIHTPNSSPHNTDDDDDSGDNCSGRGGSNASALSYKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQHDSASGYKLSKALILQKSIDYIGYLNQQKKKQEEDSAALQKEVTALRIIQNSYEHMLQHQQANPGPEEARLTDEAKFQVFQAVMDEMFETFQNIPMDNFKQLTTGVIPWLEEHCKPHILRNILSRTLQEMSIQQQQQQQQQQKQQRPQNAPQGFSQNQLKQHNQQQQQKQQQQQQQADKLDNVSKVKILYAPMRESLLTTFRAAAFTLQQNNLTDNLKREIINSSKFDKHLEEFYAYCDQIELQLKTVMQCMQQLSSSQHYMPGAVAPSRTEPYLQDNPGPMPYPTFLNTVRVHIQSTKDLRDTLISASQNISQAD
Length435
PositionTail
OrganismMusca domestica (House fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea> Muscidae> Musca.
Aromaticity0.06
Grand average of hydropathy-0.997
Instability index70.38
Isoelectric point6.07
Molecular weight49712.64
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
protein dimerization activity	GO:0046983	IEA:InterPro
transcription factor binding	GO:0008134	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10774
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.59|      13|      30|     252|     264|       1
---------------------------------------------------------------------------
  252-  264 (26.79/ 8.80)	QQQQQQQQQQKQQ
  283-  295 (26.79/ 8.80)	QQQQQKQQQQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.23|      28|      30|     118|     147|       2
---------------------------------------------------------------------------
  118-  147 (45.91/40.53)	QQHDSASGYKLSKAL.ILQKSidYIGYLNQQ
  151-  179 (43.32/30.81)	QEEDSAALQKEVTALrIIQNS..YEHMLQHQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.13|      20|      33|      27|      59|       3
---------------------------------------------------------------------------
   27-   46 (38.00/49.75)	QDTSSIDN.RGEGQKHYSRCS
   63-   83 (31.14/11.87)	DDDDSGDNcSGRGGSNASALS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.64|      22|      32|     300|     322|       5
---------------------------------------------------------------------------
  300-  322 (32.25/28.24)	DNVsKVKILYAPMRESLLTTFRA
  334-  355 (37.39/27.42)	DNL.KREIINSSKFDKHLEEFYA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10774 with Med29 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EMSIQQQQQQQQQQKQQRPQNAPQGFSQNQLKQHNQQQQQKQQQQQQQAD
2) MAEQQHSTDLLGVPCKDEYSGSTMMDQDTSSIDNRGEGQKHYSRCSSAGSIHTPNSSPHNTDDDDDSGDNCSGRGGSNASALSYKERRREAHTQAEQKRRDAIKKGYDSLQELVPT
248
1
297
116










Molecular Recognition Features






MoRF SequenceStartStop




NANANA