<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10766
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSFHLSTKERLLLLIDDMELIAKELIDNLLPKHQKSTSEHTALVDLLVAKDEEFRKMLELADEQAKLKQKMDELKAKVDVQDREIQKLQKSLKEAEQILATAIFQARQKLASIKQANKRPVSSEELIKYAHRISSANAVSAPITWCIGDVRRPYPTDIEMRNGFLGKSDLNINGGGVVHQNNMTDNQRSVNEVPNAFQNQFNWTNMGELHMSMGSSGNSVALETRSHKEASQDDVEVMSTDSSSSSSSDSQ |
Length | 251 |
Position | Middle |
Organism | Musca domestica (House fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Muscoidea>
Muscidae> Musca.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.598 |
Instability index | 48.94 |
Isoelectric point | 5.70 |
Molecular weight | 28140.42 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10766
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.88| 12| 15| 222| 233| 2
---------------------------------------------------------------------------
222- 233 (20.12/12.71) LETRSHKEASQD
238- 249 (19.75/12.35) MSTDSSSSSSSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.41| 10| 15| 25| 34| 3
---------------------------------------------------------------------------
25- 34 (17.93/14.69) LIDNLLPKHQ
43- 52 (15.47/11.71) LVDLLVAKDE
---------------------------------------------------------------------------
|