<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10738
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | QLQMSDSSRISAFPLPPMQYVNCYTDERVHSGTAPPPPRPLDSSYAMFGMPCTKEDAVIHSLESQGIRRLYPALYDHKRELKKLNFSILANYLDLMDIVVKCPDSQERLQKLEHMKTLFINVHHLINEYRPLQARDTLIEMLSLQSSVTHQSVDTASRYLARADAVVGRAAAASVGGDEDEPMRGADEAAGGEISQALLNDIDKLSAELSELTAAAAELDDAESAGFDLFASRGDDGNGDEAAGDSATDDVELEVDSDETSEDDDEADEAGEAVVNLPAGHQAAVGFSSTGNDAASGSLAQAPAAEAAVGASDEAPSVLDDLDSLLAFN |
| Length | 329 |
| Position | Middle |
| Organism | Macrostomum lignano |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes>
Rhabditophora> Macrostomorpha> Macrostomida> Macrostomidae> Macrostomum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.339 |
| Instability index | 41.75 |
| Isoelectric point | 4.19 |
| Molecular weight | 35045.01 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10738
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 103.23| 25| 25| 221| 245| 1
---------------------------------------------------------------------------
221- 245 (44.96/19.58) DAESAGF.DLFASRGDDGNGDEAAGD
250- 272 (35.78/14.30) DVELE.V.DSDETSEDDDEADE.AGE
293- 315 (22.49/ 6.66) DAASGSLaQAPAAEAAVGASDEA...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.45| 10| 25| 76| 85| 2
---------------------------------------------------------------------------
76- 85 (17.03/12.68) DHKRELKKLN
104- 113 (16.41/11.97) DSQERLQKLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.89| 17| 24| 178| 194| 3
---------------------------------------------------------------------------
178- 194 (29.98/17.79) DEDEPMRGADE..AAGGEI
201- 219 (20.91/10.19) DIDKLSAELSEltAAAAEL
---------------------------------------------------------------------------
|