| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKAQQQQQQQPPNAQLQASVSPRIKIVLGEKPSVTHCNPFYLMSKEPPQEAPLTGASNLIKHHDLEQAYSMYCTRRLREELSCFLPGLPGQIDTNGFEDGSSLSEMIERPPVTGKDLAPLSANAMSAFRLHEGPVPPELAQLFNKPPPQQQQQQQPQPPTPQSSQQSQQPPGRTRKRRHEAVITDLIGSSHNESNPGDNTSASSNTIAASQSTAASSSVGVTSAQPVSAPSAAA |
| Length | 234 |
| Position | Head |
| Organism | Macrostomum lignano |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Rhabditophora> Macrostomorpha> Macrostomida> Macrostomidae> Macrostomum. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.731 |
| Instability index | 81.80 |
| Isoelectric point | 6.59 |
| Molecular weight | 25143.70 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP10733
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.59| 21| 21| 117| 137| 2
---------------------------------------------------------------------------
117- 137 (37.21/12.93) LAPLSANAMSAFRLHEGPVPP
139- 159 (40.38/14.51) LAQLFNKPPPQQQQQQQPQPP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EAVITDLIG 2) PFYLMSK 3) PRIKIVL | 180 39 22 | 188 45 28 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab