Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKAQQQQQQQPPNAQLQASVSPRIKIVLGEKPSVTHCNPFYLMSKEPPQEAPLTGASNLIKHHDLEQAYSMYCTRRLREELSCFLPGLPGQIDTNGFEDGSSLSEMIERPPVTGKDLAPLSANAMSAFRLHEGPVPPELAQLFNKPPPQQQQQQQPQPPTPQSSQQSQQPPGRTRKRRHEAVITDLIGSSHNESNPGDNTSASSNTIAASQSTAASSSVGVTSAQPVSAPSAAA |
Length | 234 |
Position | Head |
Organism | Macrostomum lignano |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Rhabditophora> Macrostomorpha> Macrostomida> Macrostomidae> Macrostomum. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.731 |
Instability index | 81.80 |
Isoelectric point | 6.59 |
Molecular weight | 25143.70 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10733 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.59| 21| 21| 117| 137| 2 --------------------------------------------------------------------------- 117- 137 (37.21/12.93) LAPLSANAMSAFRLHEGPVPP 139- 159 (40.38/14.51) LAQLFNKPPPQQQQQQQPQPP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EAVITDLIG 2) PFYLMSK 3) PRIKIVL | 180 39 22 | 188 45 28 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab