<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10712
| Description |
Uncharacterized protein |
| Sequence | QPQAGKQPRAWMDADFRRQLSARRERVEDAFEFEGRKLRPGVQDQARSCADAPAGDYALKQIEGSGLSMSACREIALLRELKHPNVISLKQVYLAHETRQIWLLFDYAEHDLWRMINFHASAKKCNSQVSLPPNFTKSIMHQILCGIHYLHSNWVLHRDLKPANILVMGTTSPERGRVKIADLGLARLFHQPLTPLTEIDPVVVTFWYRAPELLLGARHYTKAIDLWAIGCIMAELITDKPLFYCKQEEDIKTSSPYNRDQLERIFSVMGFPSQQDWRDLPHLPKYGDLVRNFGTGSSTPASAWAGT |
| Length | 307 |
| Position | Kinase |
| Organism | Macrostomum lignano |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes>
Rhabditophora> Macrostomorpha> Macrostomida> Macrostomidae> Macrostomum.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.370 |
| Instability index | 53.20 |
| Isoelectric point | 8.69 |
| Molecular weight | 35052.81 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10712
No repeats found
|