Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MLSVLEDIELLSKALFEALATREQCSTSDRSASGQQQQQQQPLELNCEALVEQLRLREAKLHRLRDQAAKQQQLHEKANQLRALIDQQDLAIGQHQRQLMEADRLLSVAIFYSRQKLESLQTACQNPADSEELVKFAHKISASNGVMAPLGWGLGDPRRPYPTANEMARGLLKHVDEHGNFQPGIVEEVASLSAAAAAAAAAAAAGRQQQQQQQQQQQQQQQYPQQMSASSAASSTAQAQPTAGASAEQVETMSSDSSSSSSSGD |
Length | 265 |
Position | Middle |
Organism | Macrostomum lignano |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Rhabditophora> Macrostomorpha> Macrostomida> Macrostomidae> Macrostomum. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.630 |
Instability index | 61.66 |
Isoelectric point | 5.30 |
Molecular weight | 28772.51 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10711 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.15| 10| 170| 32| 41| 1 --------------------------------------------------------------------------- 32- 41 (20.84/ 6.58) ASGQQQQQQQ 213- 222 (20.31/ 6.26) QQQQQQQQQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.05| 16| 33| 8| 23| 2 --------------------------------------------------------------------------- 8- 23 (25.64/17.42) IELLSKALFEALATRE 43- 58 (27.41/19.06) LELNCEALVEQLRLRE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.74| 21| 24| 70| 90| 4 --------------------------------------------------------------------------- 70- 90 (35.53/19.43) KQQQLHEKANQLRALI..DQQDL 95- 117 (28.21/14.11) HQRQLMEADRLLSVAIfySRQKL --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) AAAAAAGRQQQQQQQQQQQQQQQYPQQMSASSAASSTAQAQPTAGASAEQVETMSSDSSSSSSSGD 2) GWGLGDPRRPYPTANEMARGLLKHVDEHGN | 200 151 | 265 180 |
MoRF Sequence | Start | Stop |
1) QYPQQMSA 2) STAQAQPTAGASAEQVETM | 222 235 | 229 253 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab