<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10687
| Description |
Uncharacterized protein |
| Sequence | MSMIDNEFREKVAQKREKVDDLYHYRGQKIGSGAYGQVYKAISKDPNVKNIYALKLIDGQGTNGIAMSVCREISLVMELKCVNIIKIHRIFFAPEKKIWLLFDYAEHDLWHIIKYHRTMKVKKERVDVSASMIKSILFQILQGIDYLHENWILHRDIKPANILVMGEGIERGTVKIADMGFARIYHNPLKPLTHIDPIVVTYWYRSPELLLGTKHYTKAIDLWAIGCIFAELMISEPIFYCPDEDTKASTPYNKGQIRRILQILGYPNEADWKDIKHMPNYTKFLQDFNKTHFTNCCLKKYIVDKHKIKYDTREYVLLKNLLIMDPIKRITAAEALSDEFFRNEPEATKDVFNGLPIPYPKREFIIDKGDDLLTNLDFELSQPPKIQLPPKKLMEIDGENCRKQDVKVSISGENLVQCQRKRPLHNRTIEEEIAEHQRMIERQQQHDLIQNPQQLEFNQYPQQQQFNQQQQLDQQLQQQEMFWIQNQNYGCHQQEGPR |
| Length | 498 |
| Position | Kinase |
| Organism | Rhabditophanes sp. KR3021 |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Alloionematidae>
Rhabditophanes> unclassified Rhabditophanes.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.562 |
| Instability index | 42.13 |
| Isoelectric point | 8.18 |
| Molecular weight | 58706.07 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10687
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.19| 25| 27| 65| 89| 1
---------------------------------------------------------------------------
65- 89 (43.74/36.62) IAMSVCREISLVM...ELKCVNIIKIHR
90- 117 (43.45/36.32) IFFAPEKKIWLLFdyaEHDLWHIIKYHR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.58| 15| 27| 443| 457| 2
---------------------------------------------------------------------------
443- 457 (28.17/16.12) QQQHDLIQNPQQLEF
467- 481 (27.42/15.51) NQQQQLDQQLQQQEM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.02| 24| 27| 11| 36| 4
---------------------------------------------------------------------------
11- 36 (37.48/30.47) KVAQKREKVDDLYHYRgqKI.GSGAYG
40- 64 (36.55/22.62) KAISKDPNVKNIYALK..LIdGQGTNG
---------------------------------------------------------------------------
|