<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10684
Description |
Uncharacterized protein |
Sequence | MQPSGSSNLTATSLTNKSHANKAMTIQEYKGRLKDLIKSINDNFAQILMAAKPTQFDESKDANRQKLAESATDTNEMAVRAATILKSTDGLFRLIQDMKEFLILRDFSFLSESVEKAQISNYVAVSNEVHLRDEAMLLLNGMIDDIDSEMRNNFGLTM |
Length | 158 |
Position | Head |
Organism | Rhabditophanes sp. KR3021 |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Alloionematidae>
Rhabditophanes> unclassified Rhabditophanes.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.359 |
Instability index | 25.34 |
Isoelectric point | 5.20 |
Molecular weight | 17684.90 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10684
No repeats found
No repeats found
|