Description | Uncharacterized protein |
Sequence | MQHSSATKPNATAKTTNKSHANKAMTIQDYKGRLKDNIKSINDNVAQILNCAKTSGPEESVANNTNKFAEYYTTRNEAATRAALILKSADELLRLTQDIKEFLVLRDFSFLTQTVKEAEQRCKTETDGVLVNYDNNVSAINGMIDDIDEEISQNFNLLY |
Length | 159 |
Position | Head |
Organism | Rhabditophanes sp. KR3021 |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Alloionematidae> Rhabditophanes> unclassified Rhabditophanes. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.614 |
Instability index | 28.97 |
Isoelectric point | 5.44 |
Molecular weight | 17813.68 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10681 No repeats found |
MoRF Sequence | Start | Stop |
1) KAMTIQDYKGRLKD 2) KFAEYYTTR | 23 67 | 36 75 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab