| Description | Uncharacterized protein |
| Sequence | MQHSSATKPNATAKTTNKSHANKAMTIQDYKGRLKDNIKSINDNVAQILNCAKTSGPEESVANNTNKFAEYYTTRNEAATRAALILKSADELLRLTQDIKEFLVLRDFSFLTQTVKEAEQRCKTETDGVLVNYDNNVSAINGMIDDIDEEISQNFNLLY |
| Length | 159 |
| Position | Head |
| Organism | Rhabditophanes sp. KR3021 |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Alloionematidae> Rhabditophanes> unclassified Rhabditophanes. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.614 |
| Instability index | 28.97 |
| Isoelectric point | 5.44 |
| Molecular weight | 17813.68 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP10681 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) KAMTIQDYKGRLKD 2) KFAEYYTTR | 23 67 | 36 75 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab