<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10674
| Description |
Uncharacterized protein |
| Sequence | MAGNFWKSSHNSQWIFDKSDLVRERARDMKNITDEEYQKVMIFYCNFIHAIGTDTLNGVNNKVKMHVIATACVYFRRFYARQSFMDIDPFLLAPTCICLASKADEFSMMSTSKLISTVSNALKKWTFLNQEILIRPPYIQEAEFLLLEIMDCCLIVYHPYRTLHVLITDLKNTYKELKADIEVIHGEAVKYCNDHYRSDICILYPPHQIAYACLVLAMINLKKQDDYAEWFTDSSVEIDKVHEIIVAIGAMYRVWKDFIEKEQLPKILEKIPRPNTRAAEISKKEAL |
| Length | 287 |
| Position | Kinase |
| Organism | Rhabditophanes sp. KR3021 |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Alloionematidae>
Rhabditophanes> unclassified Rhabditophanes.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.108 |
| Instability index | 45.36 |
| Isoelectric point | 6.51 |
| Molecular weight | 33500.63 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10674
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.95| 20| 49| 151| 171| 3
---------------------------------------------------------------------------
151- 171 (35.55/25.47) DCClIVYHP....YRTLHVLITDLK
199- 222 (33.40/19.38) DIC.ILYPPhqiaYACLVLAMINLK
---------------------------------------------------------------------------
|