Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MEVTEDEVQRTSSNILPEGNAKAVAVEKLMTLLNSREAIQAQKELMAEQKKQALAEENARKLKDGTSRIDAFIGLSRDVPVTQHLLGSFDILDIYNLRGEYQKMAGDNKLSTDLMSFVPFVGGKLSNPTYNRVSGMLRELYERPPICDKEIISFSPSMLNGFKLQPVKLDPKYCMEGNVMEIISDSIRDEGNASQCEDLDETKDGDKSLWLSSTGGDKSRKRQRTKEEKELRKKQKLERKETKKLRKEIHHEATSG |
Length | 256 |
Position | Head |
Organism | Rhabditophanes sp. KR3021 |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Alloionematidae> Rhabditophanes> unclassified Rhabditophanes. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.779 |
Instability index | 45.34 |
Isoelectric point | 6.87 |
Molecular weight | 28998.70 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10672 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.52| 25| 181| 36| 63| 2 --------------------------------------------------------------------------- 36- 63 (34.21/31.57) REAIQAQKELmaeQKKQALAEENARKLK 222- 246 (40.30/27.70) RQRTKEEKEL...RKKQKLERKETKKLR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GDKSLWLSSTG 2) QRTKEEKELRKKQKLERKETKKLRKEIHHEAT | 205 223 | 215 254 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab