<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10657
| Description |
Uncharacterized protein |
| Sequence | MADRLTQIQDLVNDLANHICNSIGVLQADPMLSCDFGSVSKEIEEEKNCQLFAQHIAHTSKDIEVLVESLPPAEQSLEVHEKELLELDDQRAQAAKELELAVEKAEKLTEQTRELLSKIAHAQMMSRPNA |
| Length | 130 |
| Position | Middle |
| Organism | Meloidogyne hapla (Root-knot nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Tylenchomorpha> Tylenchoidea> Meloidogynidae> Meloidogyninae>
Meloidogyne.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.392 |
| Instability index | 51.12 |
| Isoelectric point | 4.65 |
| Molecular weight | 14545.30 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10657
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.90| 12| 29| 73| 85| 1
---------------------------------------------------------------------------
73- 85 (15.50/12.78) AEQSLEvHEKELL
105- 116 (19.40/11.06) AEKLTE.QTRELL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.66| 12| 33| 57| 68| 3
---------------------------------------------------------------------------
57- 68 (19.52/12.90) AHTSKDIEVLVE
92- 103 (18.14/11.57) AQAAKELELAVE
---------------------------------------------------------------------------
|