<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10646
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MQNISPSQLPASIYGSTSASGNVSKELLNISTQQQTTKLPSCQYQSTECILYGSITNSEKGQFIERLKGLCDPGGPIPFFEHNMVFKLKTGSDSPVQVQMRRRFKTDNLHWHCRYIAIPETAVRDVIVRKVIDSLIYSNDMMSFVKSLGLRMEYEYIANGFLFTKRDVRVLMCSDTIGNYNKLKQFGESFLVEASILVPDGQPYDGAIKTLKEFADQLLPICKLEYLDYINK |
Length | 232 |
Position | Head |
Organism | Meloidogyne hapla (Root-knot nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Tylenchomorpha> Tylenchoidea> Meloidogynidae> Meloidogyninae>
Meloidogyne.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.241 |
Instability index | 43.12 |
Isoelectric point | 8.14 |
Molecular weight | 26323.01 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10646
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.55| 15| 27| 3| 17| 1
---------------------------------------------------------------------------
3- 17 (28.92/16.35) NISPSQ....LPASIYGST
29- 47 (24.64/13.11) NISTQQqttkLPSCQYQST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 133.63| 39| 39| 109| 147| 2
---------------------------------------------------------------------------
109- 147 (69.45/58.06) LHWHCRYIAIPET.AVRDVIVRKVIDSLIYSNDMMSFVKS
150- 189 (64.18/53.09) LRMEYEYIANGFLfTKRDVRVLMCSDTIGNYNKLKQFGES
---------------------------------------------------------------------------
|