<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10645
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSQQSGTTNNSLPQNVNLFPPPPIFAEGYTSDNIAKGLVLPPPPVPTKFEVFGETFDLEGALLPSLTDTGCQQLYSASGNWRSELLKLNRSLVAAFLDLVEVLIRCPDNEERIEKIETIRTLFINIHHLINEYRPVQARDTLRQLIKHQNLEITAKKLNKYTETGTAALETLNNALRNFTFDETIPKPPFNCFEDDEEAMEIGDRKIISPPIVQTSTTTTKLPLPKSVELSTGVRLMRRDIGGATQILSKFQFF |
| Length | 254 |
| Position | Middle |
| Organism | Meloidogyne hapla (Root-knot nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Tylenchomorpha> Tylenchoidea> Meloidogynidae> Meloidogyninae>
Meloidogyne.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.298 |
| Instability index | 47.74 |
| Isoelectric point | 5.38 |
| Molecular weight | 28530.26 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10645
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.45| 17| 20| 6| 23| 1
---------------------------------------------------------------------------
6- 23 (29.52/19.80) GTTNNSLPQNVNLfPPPP
28- 44 (32.93/17.41) GYTSDNIAKGLVL.PPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.24| 20| 27| 122| 147| 2
---------------------------------------------------------------------------
122- 142 (31.16/33.99) LFINIHHLiNEY..RPVQARDTL
151- 172 (25.08/10.16) LEITAKKL.NKYteTGTAALETL
---------------------------------------------------------------------------
|