<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10636
Description |
Uncharacterized protein |
Sequence | MRNIMKTFVENFTKIPPHMTDLQRLQMVPVENLFLELIDRKKNHAPALFIITEITRMSSNSSAFMLPRIARKITEVVASFRPLAEITTMLARTWMFPITAHINFNVNQQTWKLSDVGTTRLHLKGHLPFNNESLGPQTYLQYVLLKQPMNQDVIPYFVRPTSSTHHPKLQCDDILPYFVRPTSSTHHPKLQCDDILPVLILESMRAMETTEYNLESHENQYTWRQIAHLFISCLYTNHASFNKILSKLHTMLKSHNFRVARAELXXXXAHDAQESQLPSGASRTYVDPSAVHSHPH |
Length | 296 |
Position | Tail |
Organism | Steinernema glaseri |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae>
Steinernema.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.303 |
Instability index | 42.02 |
Isoelectric point | 9.10 |
Molecular weight | 33790.60 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP10636
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.77| 19| 19| 155| 173| 1
---------------------------------------------------------------------------
155- 173 (45.88/26.95) PYFVRPTSSTHHPKLQCDD
176- 194 (45.88/26.95) PYFVRPTSSTHHPKLQCDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 107.68| 24| 110| 107| 130| 2
---------------------------------------------------------------------------
92- 105 (23.54/10.87) ..RTWM.FP........ITAHINFN
107- 130 (43.99/25.50) NQQTWK.LSDVGTTRLHLKGHLPFN
219- 242 (40.15/22.76) NQYTWRqIAHLFISCLY.TNHASFN
---------------------------------------------------------------------------
|