<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10624
| Description |
Uncharacterized protein |
| Sequence | MYRKLGVASWHDSTPDKKSINRKQYKVIPDVYPQEARQEEDSMAPQRLKQGYVVSVPSYEQDTFARVPRFDKFAEEGLIKCGRFVSHIMQLKAEINAKVMIRQRPLNKDGTSSQQFIHNTSNQKMKERNQWFIDLSRMKSFMQLVRKPPYVKRKEECFDLLFEYRVPAPRAVWFLKLHTVCHMANSSSTKGKQKSSNEVVFPGTEQSVSICRAIAEVXXXXERGRLPGDG |
| Length | 230 |
| Position | Kinase |
| Organism | Steinernema glaseri |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae>
Steinernema.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.707 |
| Instability index | 49.94 |
| Isoelectric point | 9.71 |
| Molecular weight | 26232.88 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10624
No repeats found
No repeats found
|