<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10619
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MSSEDDWPSQVFRDNVISRLEPELARNRQNAPNLPVPGDARQVEEYVFQKCVSKDEYMRTIAKVINAINCNSKSAAVPSVLQTQYKGFPGGNGSGGGTNGAVPGNQVMPNGGGVENFTLSLSFSMPTSMDQKAISPNMGNRAPGVPPDPQPTHQQRQQANNQYANNSAGSGGPMPNAAGGNPLGQPPPMMAAQAAAGAVNGISPQQHSAAQQASQMNQGNHMVSPQQQAHMMNNSGNPMMGPYGMQQQPPYGMHPYGPYGGPPQEQQRQMKMERPPTAVPEGMWGQQQGQQQQMNPMYMQGPPMMAPYVSNMDHQMHPQYHPAHLNQMNAANQQQAPVSSSSVLENLINQPHYVNQGGAMPTSTSSASRMGGEFPLGNLHGFNAGGAAGGGAAGDAAQNIQMSPEEREKYDKKLLEMRKVLPALKQRAQEFRAQQKIDVAEKFDVFVSVLERRKVLNLEYLKNFESWINRKLDLIMNSQRQFDYGQPGMMGSPYXXXXTRQVRRGWAG |
| Length | 508 |
| Position | Tail |
| Organism | Steinernema glaseri |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae>
Steinernema.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.785 |
| Instability index | 54.20 |
| Isoelectric point | 8.85 |
| Molecular weight | 54887.02 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10619
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.53| 15| 15| 211| 225| 1
---------------------------------------------------------------------------
211- 225 (29.51/ 9.77) QQASQMNQ.GNHMVSP
227- 242 (27.02/ 8.27) QQAHMMNNsGNPMMGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 186.82| 61| 65| 73| 137| 2
---------------------------------------------------------------------------
39- 109 (89.08/43.57) DARQVEEYVFQKCVSKDEYM..RTIAKVinaincnsKSAAVPSVLQTQYKGFPGGNGSgGGTNGAVPGNQvMP
110- 175 (97.74/45.80) NGGGVENFTLSLSFSMPTSMdqKAISPN.....mgnRAPGVPPDPQPTHQQRQQANNQ.YANNSAGSGGP.MP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.75| 21| 21| 255| 275| 3
---------------------------------------------------------------------------
243- 258 (34.98/ 9.16) Y.G.....MQ..QQPPYGMHP.YG.P
259- 280 (36.87/10.01) Y.GGPPQEQQ..RQMKMERPP.TAvP
298- 322 (28.90/ 6.44) YmQGPPMMAPyvSNMDHQMHPqYH.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.12| 27| 31| 328| 358| 4
---------------------------------------------------------------------------
328- 358 (39.29/25.32) MNAANQQQAPVSSSSVLENLINqphyVNQGG
360- 386 (48.84/22.09) MPTSTSSASRMGGEFPLGNLHG....FNAGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.83| 15| 15| 177| 191| 5
---------------------------------------------------------------------------
177- 191 (30.39/13.49) AAGGNPLG.QPPPMMA
194- 209 (22.44/ 8.00) AAAGAVNGiSPQQHSA
---------------------------------------------------------------------------
|