<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10619

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMSSEDDWPSQVFRDNVISRLEPELARNRQNAPNLPVPGDARQVEEYVFQKCVSKDEYMRTIAKVINAINCNSKSAAVPSVLQTQYKGFPGGNGSGGGTNGAVPGNQVMPNGGGVENFTLSLSFSMPTSMDQKAISPNMGNRAPGVPPDPQPTHQQRQQANNQYANNSAGSGGPMPNAAGGNPLGQPPPMMAAQAAAGAVNGISPQQHSAAQQASQMNQGNHMVSPQQQAHMMNNSGNPMMGPYGMQQQPPYGMHPYGPYGGPPQEQQRQMKMERPPTAVPEGMWGQQQGQQQQMNPMYMQGPPMMAPYVSNMDHQMHPQYHPAHLNQMNAANQQQAPVSSSSVLENLINQPHYVNQGGAMPTSTSSASRMGGEFPLGNLHGFNAGGAAGGGAAGDAAQNIQMSPEEREKYDKKLLEMRKVLPALKQRAQEFRAQQKIDVAEKFDVFVSVLERRKVLNLEYLKNFESWINRKLDLIMNSQRQFDYGQPGMMGSPYXXXXTRQVRRGWAG
Length508
PositionTail
OrganismSteinernema glaseri
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae> Steinernema.
Aromaticity0.06
Grand average of hydropathy-0.785
Instability index54.20
Isoelectric point8.85
Molecular weight54887.02
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10619
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.53|      15|      15|     211|     225|       1
---------------------------------------------------------------------------
  211-  225 (29.51/ 9.77)	QQASQMNQ.GNHMVSP
  227-  242 (27.02/ 8.27)	QQAHMMNNsGNPMMGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     186.82|      61|      65|      73|     137|       2
---------------------------------------------------------------------------
   39-  109 (89.08/43.57)	DARQVEEYVFQKCVSKDEYM..RTIAKVinaincnsKSAAVPSVLQTQYKGFPGGNGSgGGTNGAVPGNQvMP
  110-  175 (97.74/45.80)	NGGGVENFTLSLSFSMPTSMdqKAISPN.....mgnRAPGVPPDPQPTHQQRQQANNQ.YANNSAGSGGP.MP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     100.75|      21|      21|     255|     275|       3
---------------------------------------------------------------------------
  243-  258 (34.98/ 9.16)	Y.G.....MQ..QQPPYGMHP.YG.P
  259-  280 (36.87/10.01)	Y.GGPPQEQQ..RQMKMERPP.TAvP
  298-  322 (28.90/ 6.44)	YmQGPPMMAPyvSNMDHQMHPqYH.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.12|      27|      31|     328|     358|       4
---------------------------------------------------------------------------
  328-  358 (39.29/25.32)	MNAANQQQAPVSSSSVLENLINqphyVNQGG
  360-  386 (48.84/22.09)	MPTSTSSASRMGGEFPLGNLHG....FNAGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.83|      15|      15|     177|     191|       5
---------------------------------------------------------------------------
  177-  191 (30.39/13.49)	AAGGNPLG.QPPPMMA
  194-  209 (22.44/ 8.00)	AAAGAVNGiSPQQHSA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10619 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SVLQTQYKGFPGGNGSGGGTNGAVPGNQVMPNGGGVENFTLSLSFSMPTSMDQKAISPNMGNRAPGVPPDPQPTHQQRQQANNQYANNSAGSGGPMPNAAGGNPLGQPPPMMAAQAAAGAVNGISPQQHSAAQQASQMNQGNHMVSPQQQAHMMNNSGNPMMGPYGMQQQPPYGMHPYGPYGGPPQEQQRQMKMERPPTAVPEGMWGQQQGQQQQMNPMYMQGPPMMAPYVSNMDHQMHPQYHPAHLNQMNAANQQQAPVSSSSVLENLINQPHYVNQGGAMPTSTSSASRMGGEFPL
79
376










Molecular Recognition Features






MoRF SequenceStartStop




1) YAEDFLPT
38
45