<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10612

Description Uncharacterized protein
SequenceMMGPGSMGPGSMGHGPMGPNHMGPGAMGPHGQMNPMMRPHMYHHMMSQNNPPQQAGMLPAHWNHQLRQTPYMNSPTYMGTNMGPAMGQPPNPTAFSPSYGPNFGNRPANYMATPPHRAALPSPSPGPTAIGTPATPGSVQQPASASTVFSPPPSSVQPPSSVPPPSVPPVSSVKPATEVPVENKALAIVVQLQDTVLNVHFDAAFEACPMCGCQGNIFGRDYSYITPVQPLPGKELQDTVLNVHFDAAFEACPMCGCQGNIFGRDYSYITPVQPLPGKEVTYWSGXXXXQLLEHQLLLALCNNLPVPVQYSVLRPLQFSHRPLFLHLPFLLFRP
Length334
PositionMiddle
OrganismSteinernema glaseri
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae> Steinernema.
Aromaticity0.08
Grand average of hydropathy-0.263
Instability index60.63
Isoelectric point7.23
Molecular weight35466.42
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP10612
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     217.70|      41|      41|     193|     233|       1
---------------------------------------------------------------------------
   94-  121 (24.18/ 7.43)	...........AF..SP...SYGPNFGnRPANYMaTPPHraALP.
  193-  233 (96.76/52.05)	QDTVLNVHFDAAFEACPMCGCQGNIFG.RDYSYI.TPVQ..PLPG
  237-  277 (96.76/52.05)	QDTVLNVHFDAAFEACPMCGCQGNIFG.RDYSYI.TPVQ..PLPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     110.01|      22|      41|     123|     148|       2
---------------------------------------------------------------------------
   18-   40 (35.97/ 6.36)	GPNHMGPGAmGP.HGQmNPMMRPH
   75-   93 (34.90/ 7.61)	.PTYMGTNM.GPAMGQ.PP..NPT
  126-  147 (39.14/13.62)	GPTAIGTPA.TPGSVQ.QPASAST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.82|      13|      15|     151|     163|       4
---------------------------------------------------------------------------
  151-  163 (28.01/11.72)	PPPSSVQPPSSVP
  168-  180 (25.81/10.26)	PPVSSVKPATEVP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP10612 with Med13 domain of Kingdom Metazoa

Unable to open file!