<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10606
Description |
Uncharacterized protein |
Sequence | MQVVATACVYFRRFYAKRSFKDIDPFLLAPTCVILASKVEEQGMLSSTKIVNSVAVALKKWPFLNLDVQNFRPLVMQEAEFFLLEILDCCLVVYHPYRPLMQMWNDLASMYKDCRDLEELKSLSWRICNDVLKTDASLLYAPHLIAVACIAAAAVYANRDIKLWFAEINVDYEKVFEVQHMLMTMYGLWRSFKESEQLPAILEKMPKPAQTPSLNGSQQSGQHQMNMMPM |
Length | 230 |
Position | Kinase |
Organism | Steinernema glaseri |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae>
Steinernema.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.079 |
Instability index | 49.28 |
Isoelectric point | 6.43 |
Molecular weight | 26535.96 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10606
No repeats found
|