| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MTCPLQVTRIHRTMENNGSGQYGSGSSGMNTDFSLDRFTQLERTLDQFQEIDAIKSQFADVKVPLELLEYLNSGKNPHIFTREMLLRTSEKNREVNGKIEVYTKFRANLLNELGHEVPEEILKYLDIRHMKEGNRK |
| Length | 136 |
| Position | Middle |
| Organism | Steinernema glaseri |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae> Steinernema. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.727 |
| Instability index | 25.59 |
| Isoelectric point | 6.43 |
| Molecular weight | 15790.72 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP10604
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.50| 11| 52| 62| 72| 1
---------------------------------------------------------------------------
62- 72 (19.58/ 9.93) KVPLELLEYLN
116- 126 (19.92/10.17) EVPEEILKYLD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) MTCPLQVTRIHRTMENNGSGQY 2) TDFSLDRFTQLERTLDQFQEIDA | 1 31 | 22 53 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab