| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MTCPLQVTRIHRTMENNGSGQYGSGSSGMNTDFSLDRFTQLERTLDQFQENARHLGVIATEFTSKSQEPLNQKLHTLISGLQEIDAIKSQFADVKVPLELLEYLNSGKNPHIFTREMLLRTSEKNREVNGKIEVYTKFRANLLNELGHEVPEEILKYLDIRHMKEGNRK |
| Length | 169 |
| Position | Middle |
| Organism | Steinernema glaseri |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae> Steinernema. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.674 |
| Instability index | 29.92 |
| Isoelectric point | 6.60 |
| Molecular weight | 19433.79 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP10603
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.50| 11| 51| 95| 105| 1
---------------------------------------------------------------------------
95- 105 (19.58/11.53) KVPLELLEYLN
149- 159 (19.92/11.81) EVPEEILKYLD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) MTCPLQVTRIHRTMENNGSGQY 2) TDFSLDRFTQLERTL | 1 31 | 22 45 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab