<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10601
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MICFGLSKQGFGLEKRTRSTYFFRDPNSHSGRIPRSSESSNCLVTIWTSDCDLLHGSDHIARTENKRKRKTKNGQLEEAGIRHSYSSPGSSASTEMNTNDRFTVLEKKLEEIQTFFSSPGSSASTEMNTNDRFTVLEKKLEEIQETARTVGLIASEFQSNGQRPLNQSVRGLTSLLQELDAMKSQFADVKVPLGLLECIHNGKNPNLYTREMLLRTSEKNQQANGKTQLYTKFRANLLSELGQELPEEIMKYLDVRGTPEGNRK |
Length | 264 |
Position | Middle |
Organism | Steinernema glaseri |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae>
Steinernema.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.769 |
Instability index | 46.97 |
Isoelectric point | 8.82 |
Molecular weight | 29805.15 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10601
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 137.30| 29| 30| 85| 113| 1
---------------------------------------------------------------------------
61- 82 (21.57/ 9.37) .......ARTE.NKRKRKT.KNGQLEEagIR
85- 113 (57.97/35.36) YSSPGSSASTEMNTNDRFTVLEKKLEE..IQ
116- 144 (57.77/35.22) FSSPGSSASTEMNTNDRFTVLEKKLEE..IQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 124.86| 43| 63| 148| 190| 2
---------------------------------------------------------------------------
148- 190 (72.56/40.34) RTVGLI...................ASE..FQSNGQRPLNQSVRG..LTSLLQELDAMKSQFADVK
191- 256 (52.30/27.53) VPLGLLecihngknpnlytremllrTSEknQQANGKTQLYTKFRAnlLSELGQELPEEIMKYLDVR
---------------------------------------------------------------------------
|