<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10598

Description Uncharacterized protein
SequenceMYNGAGLPGNGLGQNRQGVRVAIEPMTEWQIDSIGFDGIEKYIIPSGFADFVAKGAMKVDWRKMVESNGTFDDLSAVGVEEGQVQKPKLEMEDRKVPEAGPWHEVAKHLHETLQQVNVLGDTMKVLKSQNYIDAVTIQEEHKDEAASNNIVQNSRQFHWIARRKALTEANNIIEKAQKARDIGEKGDKDKEQFFRYAFILRQASSHRXXXXEQFFRELRELREHWRIKKVGGMILGDIGYRIFGQKYAQRDVFNIWRKKTANEGSLYANASDSKRSDLYEMPHEELEYMDLEKQKAMKVYWKQALQWAQDSLINRDIYHMLFGDSTLLQDRMCAVKKDTILVSLFDDLVLKIQKVNYKFELFGDSTLLQDRMCAVKKDTILVSLFDDLVLKIQKVNYKFEEGKLPSLGVPYLNRSLRQMFLSGLCRRTLRIPSFAYLPLTTHNLSLDMRAPHGLDRFEMELRMREEGSLLTRLITVSSHYILMERVSQTLREYTRKMKDPNLSWKLSWASPSHSLMALHFSLKNYEQFGKKSFFIKVEGDSVKILTKEQNFLDARRDPKLIMQTIHLMYSTFMVHSFVSLCRTWNWEVLHANINGVDNDKQPAPTFYACNRSARVALFVQFRSGCLPPVFMLRSAPKGLDDDTVPFVTIKYDAIPGSSTMKKAETIFGSMRD
Length672
PositionHead
OrganismSteinernema glaseri
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Steinernematidae> Steinernema.
Aromaticity0.10
Grand average of hydropathy-0.432
Instability index42.65
Isoelectric point9.01
Molecular weight77265.04
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10598
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     154.56|      37|      37|     322|     358|       1
---------------------------------------------------------------------------
  322-  358 (77.28/57.56)	FGDSTLLQDRMCAVKKDTILVSLFDDLVLKIQKVNYK
  362-  398 (77.28/57.56)	FGDSTLLQDRMCAVKKDTILVSLFDDLVLKIQKVNYK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.63|      21|      31|      52|      73|       2
---------------------------------------------------------------------------
   52-   73 (33.65/25.93)	VAKGAMKVDWRKMVESnGTFDD
   84-  104 (37.98/24.53)	VQKPKLEMEDRKVPEA.GPWHE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.91|      27|      31|     463|     493|       3
---------------------------------------------------------------------------
  463-  493 (33.56/38.80)	MReEGSLLTRLITVS.SHYiLME.RVSqtLREY
  497-  525 (43.36/29.72)	MK.DPNLSWKLSWASpSHS.LMAlHFS..LKNY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.59|      13|      20|     191|     206|       4
---------------------------------------------------------------------------
  191-  206 (20.50/21.06)	EQFFRYafiLRQASSH
  212-  224 (25.09/15.58)	EQFFRE...LRELREH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     111.08|      26|      41|     577|     602|       5
---------------------------------------------------------------------------
  543-  558 (17.09/ 6.47)	..........KILTKEQNFLDARRDP
  577-  602 (48.57/30.60)	FVSLCRTWNWEVLHANINGVDNDKQP
  621-  645 (45.42/28.18)	FRSGCLPPVF.MLRSAPKGLDDDTVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.83|      13|      20|     148|     160|       6
---------------------------------------------------------------------------
  148-  160 (24.80/17.93)	NNIVQNSRQFHWI
  170-  182 (21.03/14.11)	NNIIEKAQKARDI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10598 with Med17 domain of Kingdom Metazoa
Unable to open file!