<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10589
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MTDEDWPSQRFRDHVINRLLVASTIIAMKLEPELARNRQNAPNLPVPGDARQVEEYVFQKCLTKDEYMRTIAKVINAINCNSKSAAVPSVLQPSPFHSPPCSAPTNPSSTTTYRAAVPPDPQPTQSRNQAQVAPPQTASQPPPQASLPIAASSQPQAAFSSDQSRPYTTAPPLGQPPPQMQPATAPQMAPVQPNFSPYQMMAPSQQQIPTYDSRMQKQPKQGLHYPPQPQWNHHPQSGYAPPPQQQHHNQPPHSQSTVLETLINQPQYPPHQKLETMLGVLEGRRLVSIEYLVNLENWIHKKADFLAATTHNPQSMQNGHGMQSQGMVDGINAVLNGAEGHPAGIYQTPPSSGGYAPPHQYMQQQMWNHPQHIQQQQQSQQQISSMGSMSSSATASQSASTTAVGVQGGSSGSAGSAEQPGVDDLYNMDDFLPTPLEAVGGPPGSIQPIPVSTLFIYKRAKASLSEMARRELSLLSDRFEIDNNPEPHDSHSVLVKCRISKFFNLVNSIYIVMLSVLEGQQVPPLRLVIPSIYPNGSVSVDRAAIDLDAYFYDDLQNVVHDRLARPGLHSITDFLNSWEATVRQYYSNQTHGSTALSSFDDLFQSYDNIIT |
| Length | 611 |
| Position | Tail |
| Organism | Heterorhabditis bacteriophora (Entomopathogenic nematode) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Strongyloidea> Heterorhabditidae> Heterorhabditis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.579 |
| Instability index | 65.43 |
| Isoelectric point | 6.07 |
| Molecular weight | 67207.39 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10589
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
7| 241.66| 22| 22| 118| 139| 1
---------------------------------------------------------------------------
88- 109 (35.68/10.10) PSVLQ...PSPFHSPPCSAPTNPSS
118- 139 (41.70/13.05) PPDPQ...PTQSRNQAQVAPPQTAS
141- 164 (30.88/ 7.75) PP.PQaslPIAASSQPQAAFSSDQS
177- 195 (35.82/10.17) PPQMQ...PATA...PQMAPVQPNF
226- 239 (30.51/ 7.56) PPQPQ.....WNHH......PQSGY
241- 256 (34.95/ 9.74) PP.PQ....QQHHNQ....PPHSQS
356- 379 (32.14/ 8.36) APPHQ.ymQQQMWNHPQHIQQQQQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.16| 23| 69| 333| 355| 2
---------------------------------------------------------------------------
333- 355 (42.15/18.63) AV.LNGAEGHPAGIYQTPPSSGGY
403- 426 (31.39/12.14) AVgVQGGSSGSAGSAEQPGVDDLY
434- 452 (25.62/ 8.65) TP.LEAVGGPPGSIQPIPVS....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.84| 10| 28| 166| 175| 4
---------------------------------------------------------------------------
166- 175 (20.11/ 9.85) PYTTAPPLGQ
197- 206 (20.72/10.38) PYQMMAPSQQ
---------------------------------------------------------------------------
|