<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10589

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMTDEDWPSQRFRDHVINRLLVASTIIAMKLEPELARNRQNAPNLPVPGDARQVEEYVFQKCLTKDEYMRTIAKVINAINCNSKSAAVPSVLQPSPFHSPPCSAPTNPSSTTTYRAAVPPDPQPTQSRNQAQVAPPQTASQPPPQASLPIAASSQPQAAFSSDQSRPYTTAPPLGQPPPQMQPATAPQMAPVQPNFSPYQMMAPSQQQIPTYDSRMQKQPKQGLHYPPQPQWNHHPQSGYAPPPQQQHHNQPPHSQSTVLETLINQPQYPPHQKLETMLGVLEGRRLVSIEYLVNLENWIHKKADFLAATTHNPQSMQNGHGMQSQGMVDGINAVLNGAEGHPAGIYQTPPSSGGYAPPHQYMQQQMWNHPQHIQQQQQSQQQISSMGSMSSSATASQSASTTAVGVQGGSSGSAGSAEQPGVDDLYNMDDFLPTPLEAVGGPPGSIQPIPVSTLFIYKRAKASLSEMARRELSLLSDRFEIDNNPEPHDSHSVLVKCRISKFFNLVNSIYIVMLSVLEGQQVPPLRLVIPSIYPNGSVSVDRAAIDLDAYFYDDLQNVVHDRLARPGLHSITDFLNSWEATVRQYYSNQTHGSTALSSFDDLFQSYDNIIT
Length611
PositionTail
OrganismHeterorhabditis bacteriophora (Entomopathogenic nematode)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida> Strongyloidea> Heterorhabditidae> Heterorhabditis.
Aromaticity0.07
Grand average of hydropathy-0.579
Instability index65.43
Isoelectric point6.07
Molecular weight67207.39
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10589
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             7|     241.66|      22|      22|     118|     139|       1
---------------------------------------------------------------------------
   88-  109 (35.68/10.10)	PSVLQ...PSPFHSPPCSAPTNPSS
  118-  139 (41.70/13.05)	PPDPQ...PTQSRNQAQVAPPQTAS
  141-  164 (30.88/ 7.75)	PP.PQaslPIAASSQPQAAFSSDQS
  177-  195 (35.82/10.17)	PPQMQ...PATA...PQMAPVQPNF
  226-  239 (30.51/ 7.56)	PPQPQ.....WNHH......PQSGY
  241-  256 (34.95/ 9.74)	PP.PQ....QQHHNQ....PPHSQS
  356-  379 (32.14/ 8.36)	APPHQ.ymQQQMWNHPQHIQQQQQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      99.16|      23|      69|     333|     355|       2
---------------------------------------------------------------------------
  333-  355 (42.15/18.63)	AV.LNGAEGHPAGIYQTPPSSGGY
  403-  426 (31.39/12.14)	AVgVQGGSSGSAGSAEQPGVDDLY
  434-  452 (25.62/ 8.65)	TP.LEAVGGPPGSIQPIPVS....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.84|      10|      28|     166|     175|       4
---------------------------------------------------------------------------
  166-  175 (20.11/ 9.85)	PYTTAPPLGQ
  197-  206 (20.72/10.38)	PYQMMAPSQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10589 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ADFLAATTHNPQSMQNGHGMQSQGMVDGINAVLNGAEGHPAGIYQTPPSSGGYAPPHQYMQQQMWNHPQHIQQQQQSQQQISSMGSMSSSATASQSASTTAVGVQGGSSGSAGSAEQPGVDDLYN
2) AVPSVLQPSPFHSPPCSAPTNPSSTTTYRAAVPPDPQPTQSRNQAQVAPPQTASQPPPQASLPIAASSQPQAAFSSDQSRPYTTAPPLGQPPPQMQPATAPQMAPVQPNFSPYQMMAPSQQQIPTYDSRMQKQPKQGLHYPPQPQWNHHPQSGYAPPPQQQHHNQPPHSQSTVLETLINQPQYPPHQKLETM
303
86
427
277










Molecular Recognition Features






MoRF SequenceStartStop




NANANA