Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MGETTGSSWSAAGGGSTSASVSTGSLSSLKMLVEKPPITGKEINTLTSTAMSGFRLNPGPVDERYRFLFEKKRDSDGMPSFDVDRKDYGSGQRYKHSLDSLDVDEPERKKHKSEKKEKKKKKEKKKKDKKDEERKHKKTSEVPVPTGQPMIEF |
Length | 153 |
Position | Head |
Organism | Heterorhabditis bacteriophora (Entomopathogenic nematode) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida> Strongyloidea> Heterorhabditidae> Heterorhabditis. |
Aromaticity | 0.06 |
Grand average of hydropathy | -1.249 |
Instability index | 38.28 |
Isoelectric point | 9.58 |
Molecular weight | 17141.17 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10588 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 71.04| 16| 17| 104| 119| 1 --------------------------------------------------------------------------- 81- 96 (23.94/ 9.46) FDVDRKDYGSGQRYKH 104- 119 (25.51/10.45) DEPERKKHKSEKKEKK 123- 138 (21.59/ 7.98) EKKKKDKKDEERKHKK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QPMIEF 2) SGFRLNPGPVDERYRFLFEKKRDSDGMPSFDVDRKDYGSGQRYKHSLDSLDVDEPERKKHKSEKKEKKKKKEKKKKDKKDEERKHKKTSEV | 148 52 | 153 142 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab