<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10577
| Description |
Uncharacterized protein |
| Sequence | MSNCEDEVLAIGKKLEKMIDGTKSVTKSFKYNLLCLQKTRIGMTINDLRKKTSDEKLAKKAKNLIREWKNLLEKKDEKKEKVHKGTGDKYKSALRSRVFNLRDKKNPALRFVLFLFESNDNDRFFLPILKSGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCLECGNRWKFC |
| Length | 178 |
| Position | Unknown |
| Organism | Heterorhabditis bacteriophora (Entomopathogenic nematode) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Strongyloidea> Heterorhabditidae> Heterorhabditis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.733 |
| Instability index | 35.89 |
| Isoelectric point | 9.66 |
| Molecular weight | 20702.02 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10577
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.84| 21| 66| 13| 33| 1
---------------------------------------------------------------------------
13- 33 (36.54/28.32) KKLEKMIDGT....KSVTKSFKYNL
77- 101 (30.30/22.22) EKKEKVHKGTgdkyKSALRSRVFNL
---------------------------------------------------------------------------
|