| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MDPAGSGVASSGSLRTKISLKGRYSQLSLVCPFHLMKPELPQQSVLLGSNDLLAEYDMSSSYQRFCGSKRLREDLGSFLPHLVGSFNFENALEFSSLRMLVEKPPITGKEITSLSASAMAGFRLTPGAVPEPYRYFDNKVDDLSSESINYDENGEELRHKRKFKWSLDDLDDADSDRKYRKHRSEDKDRKKEKKKKKDKKRKRDSKEEDPNNKIRKI |
| Length | 217 |
| Position | Head |
| Organism | Loa loa (Eye worm) (Filaria loa) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Loa. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.978 |
| Instability index | 48.02 |
| Isoelectric point | 9.31 |
| Molecular weight | 24870.86 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP10553
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.81| 24| 26| 141| 164| 1
---------------------------------------------------------------------------
134- 160 (35.77/16.62) RYFDnkvDDLSSESIN..YDENGEELRHK
161- 189 (32.04/14.28) RKFKwslDDLDDADSDrkYRKHRSEDKDR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EPYRYFDN 2) SDRKYRKHRSEDKDRKKEKKKKKDKKRKRDSKEEDPNNKIRKI | 131 175 | 138 217 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab