Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MDPAGSGVASSGSLRTKISLKGRYSQLSLVCPFHLMKPELPQQSVLLGSNDLLAEYDMSSSYQRFCGSKRLREDLGSFLPHLVGSFNFENALEFSSLRMLVEKPPITGKEITSLSASAMAGFRLTPGAVPEPYRYFDNKVDDLSSESINYDENGEELRHKRKFKWSLDDLDDADSDRKYRKHRSEDKDRKKEKKKKKDKKRKRDSKEEDPNNKIRKI |
Length | 217 |
Position | Head |
Organism | Loa loa (Eye worm) (Filaria loa) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Loa. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.978 |
Instability index | 48.02 |
Isoelectric point | 9.31 |
Molecular weight | 24870.86 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10553 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.81| 24| 26| 141| 164| 1 --------------------------------------------------------------------------- 134- 160 (35.77/16.62) RYFDnkvDDLSSESIN..YDENGEELRHK 161- 189 (32.04/14.28) RKFKwslDDLDDADSDrkYRKHRSEDKDR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EPYRYFDN 2) SDRKYRKHRSEDKDRKKEKKKKKDKKRKRDSKEEDPNNKIRKI | 131 175 | 138 217 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab