<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10541

Description Uncharacterized protein
SequenceMPPANETINSHIQFIRDGIENFDSSNTAMLAVISNVCRIDNKASKVSLVALNQMIETVDPAQPLFELSYQRYAVNSFAALPLEFMDALTLRTKKYLFQQSFNYLRSFSSEKLPSPSVFETIVLFCRAEDYESAAKDLEMMAMRSLHVTNAVDRSVGDNQNMQKDQCHFLFDFLTYRIPFLHVYSKYSNIVNVLLHFSQQPANNPQNHQIYRLVEQFLMRRWNWRGCHEIITNMTVLFGVNHKENSLMRHMTNPKTFSQPVDNYQFPINPGLLKMALYSFFRAVKITGHEIIVENTLFPTIVSGFGWPEKSTTYFPKWAIDAIKTKDPASFLPNYDEIIQSVHEVARLHPSLTPHQFLIKYGEDHDPLTVYSMMAVLFRIAYTAGDTKPDITSEFYEVMEKKSPKDVVIMGTYLIDYIIADAKTQDCNEQTFKNIAKAAALLIFQWQIQRADRFLLSLIVHPTTDEDAHLCIQIANEFILTPEFQERIKWFHSNVPKKDVNPTEYIKAIVKYHDMFPEFEVCQLAVKNENVNPHLPTYYGCLIERLLPVLDQYLFVALEQQGYKLHPQILQTIALFYKYHATPIHLMYSILFTSHGKMSGPDAKSFVLTFASQIEECHLTEAFEKYNHQKTSREQLLMELIDRMSASLDFVLTPPPFVAKDWKSAELNPGAQTLYLSCIELMASPHSPETLVAAMINVMQMKPHLRPFNVINLIALLLTALPSSYAEALHEEFVAVFDNNETRNLKFEEIVFDNYEESLLLNLPNRARSINVISQNYWTHCNLSLLNSFAQEYVPKLLEHAKTEKDLWYTLRLCMPIIRRYWENWDTAKQMRSQREKFGPLFIMKLIFEKLGAMAEAGVEFVHEQHLCDLFYNCKYVFTGDFLRDTAITEFAKLPEPMRDRLKFYVSQSEPSTQQNEEKEKTPEREPEPEPAPQAPEPPAPAPQQVQHQPIQMQPMMPPPPPQPLHHLQMQHHMDFHPQQPMMAPPTPAQHQLPNMSMHQPYPGAVFHHQMQYGMPHHMHLHPQMQMQQQMPQQMHMNPMMHNMTPQQQYAYMQYMQHQQQQQHHHQPPHM
Length1070
PositionTail
OrganismCaenorhabditis tropicalis
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis.
Aromaticity0.11
Grand average of hydropathy-0.359
Instability index51.38
Isoelectric point6.12
Molecular weight124590.88
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10541
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     139.03|      15|      15|    1010|    1024|       1
---------------------------------------------------------------------------
  952-  967 (22.45/ 6.40)	MQPMMppPPPQPLH.HL
  969-  979 (24.29/ 7.51)	MQ......HHMDFHPQQ
  982-  995 (24.58/ 7.68)	MAPPT..PAQHQL.PNM
 1010- 1024 (36.70/15.01)	MQYGM..PHHMHLHPQM
 1026- 1040 (31.00/11.56)	MQQQM..PQQMHMNPMM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.89|      20|      32|     481|     504|       2
---------------------------------------------------------------------------
  481-  504 (35.51/30.65)	PEFQerikWFHSNVPKKDVN...PTEY
  516-  538 (33.37/19.25)	PEFE....VCQLAVKNENVNphlPTYY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.27|      15|      15|     671|     685|       3
---------------------------------------------------------------------------
  671-  685 (27.12/15.82)	QTLYLSCIELM.ASPH
  688-  703 (20.15/ 9.87)	ETLVAAMINVMqMKPH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.63|      12|      32|     260|     271|       4
---------------------------------------------------------------------------
  260-  271 (24.53/15.16)	VDNYQFP.INPGL
  292-  304 (18.10/ 9.20)	VENTLFPtIVSGF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.52|      12|      32|      64|      77|       5
---------------------------------------------------------------------------
   64-   77 (14.15/20.49)	LFELSYQrYaVNSF
   96-  107 (23.37/17.19)	LFQQSFN.Y.LRSF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.34|      13|      32|     894|     914|       6
---------------------------------------------------------------------------
  894-  914 (13.29/22.61)	PEpmRDrlkfyvSQSEPSTQQ
  922-  934 (26.05/11.74)	PE..RE......PEPEPAPQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     159.03|      47|     137|     207|     258|       7
---------------------------------------------------------------------------
  207-  258 (82.02/65.05)	HQIYRL.....VEQFLMRRWNWRGCHEIITNMTVLFGVNHKENSlmrhmTNPKTFSQ
  342-  393 (77.01/49.28)	HEVARLhpsltPHQFLIKYGEDHDPLTVYSMMAVLFRIAYTAGD.....TKPDITSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.55|      10|     138|     564|     575|       8
---------------------------------------------------------------------------
  115-  124 (18.30/ 6.06)	PSVFETIVLF
  566-  575 (18.26/ 6.02)	PQILQTIALF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10541 with Med23 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LKFYVSQSEPSTQQNEEKEKTPEREPEPEPAPQAPEPPAPAPQQVQHQPIQMQPMMPPPPPQPLHHLQMQHHMDFHPQQPMMAPPTPAQHQLPNMSMHQPYPGAVFHHQMQYGMPHHMHLHPQMQMQQQMPQQMHMNPMMHN
901
1042










Molecular Recognition Features






MoRF SequenceStartStop




NANANA