<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10539
| Description |
Uncharacterized protein |
| Sequence | MIDENFKKQLAIQRERVEDLFYFENSKEIGRGTYGLVYKAVPKQPNGRFPNKEYALKMIEGQGFSMSACREIALFRELRHPNLICLQRVFLTNEKKVWLLLDYAEHDLWHVIKHHRTAKTKKVPIMVPRNMVKNILFQILSGMHYLHSNWVLHRDLKPANILLMGDGPPDMRGRQDRYNQS |
| Length | 181 |
| Position | Kinase |
| Organism | Caenorhabditis tropicalis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.516 |
| Instability index | 52.52 |
| Isoelectric point | 9.69 |
| Molecular weight | 21418.76 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10539
No repeats found
|