Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MMPRMGPPSTARQDNPLYVSFRNPQWPPNFINRDNVLDYFCNQANTFYEMNSCNQQIKMQNITNRSVEECLRTMQGVQYVVWYAQPPLFIICKQRRNNVNNVSPISYYYVVNGSVHQAPDMYSLIQSRLLGALEPLRNAFGEVTNYSRYNTAKGYYWEFKNKPNVKKREEEKKDDEDDKLEERSTNFQKNRTLMLLNQLFTEMPSDDALEREEVEEEAAEKPEEASASSTTGEPKFAEPAARATTK |
Length | 246 |
Position | Head |
Organism | Caenorhabditis tropicalis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.900 |
Instability index | 55.64 |
Isoelectric point | 5.34 |
Molecular weight | 28660.75 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10535 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 128.37| 39| 39| 144| 182| 1 --------------------------------------------------------------------------- 144- 182 (68.19/39.14) TNYSRYNTAKGYYWEFKNKPNVKKREEEKKDDE.DDKLEE 185- 224 (60.18/33.83) TNFQKNRTLMLLNQLFTEMPSDDALEREEVEEEaAEKPEE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 121.18| 37| 60| 27| 65| 2 --------------------------------------------------------------------------- 27- 65 (66.40/45.10) PPNFI....NRDNVLDyfCNQANTFYEMN.SCNQQIKMQN.ITNR 86- 128 (54.78/30.74) PPLFIickqRRNNVNN..VSPISYYYVVNgSVHQAPDMYSlIQSR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LEREEVEEEAAEK 2) TTGEPKFAEPAARATTK 3) YYWEFK | 209 230 155 | 221 246 160 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab