<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10534

Description Uncharacterized protein
SequenceMGRAWNDSGVVKCTFVTDNKIYSGPDVGGSIQLLVIDPGEKPRSFHYDWVNYKKAQSLTMEGKYEMVRCEYSASVYWPEYGLLGCVSTDKRIAYFVDNDSKIKSTKKIEDLLVLCKIAGSKESHVSEKEKEKSSIGNSIRLSNAVNDWEDYNWGSAWPTNRNVMSVPKNIPSVGFEQFVALWYRHGKPIMGRAWPKNGKIEASFVDVNREFTGGTVGSLQLLISLPQTTVGYEYIWMTYGQMNFAKVSSQQNQQLYSEASKIPTGSGLARDSPEDMSSSKDPDKDARKGKIPRRPEFNNGGSLEDCISNVYALLDLPGIKWKCFRPKPNAPRGLPLASDNVLKAYSKCINAGILSTWRRKPLPPSDNNEMLQAPHFSNDSAKELWVFWFDEEPESLLKYCEGLDSDEELSSANQMNIVSYEVRTILFKALHVVLERDLTKDGFVRFGRWFTVPFEARENYLHYMYPTHSPAIRFNFLFMDQTLFALQYKPRDSQHLFVWLNVISNIK
Length507
PositionMiddle
OrganismCaenorhabditis tropicalis
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis.
Aromaticity0.12
Grand average of hydropathy-0.475
Instability index39.61
Isoelectric point7.95
Molecular weight57815.98
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10534
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     182.12|      50|     186|       1|      52|       1
---------------------------------------------------------------------------
    1-   52 (87.96/78.77)	MGRAWNDSGVVKCTFVTDNKIYSGPDVgGSIQLLVIDPgEKPRSFHYDWVNY
  190-  239 (94.16/72.70)	MGRAWPKNGKIEASFVDVNREFTGGTV.GSLQLLISLP.QTTVGYEYIWMTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.62|      21|      31|     325|     346|       2
---------------------------------------------------------------------------
  294-  312 (26.58/12.49)	..RPEFNNGGSL.EDCISNV..YA
  325-  346 (32.97/21.27)	RPKPNAPRGLPLaSDNVLKA..YS
  358-  377 (26.07/12.12)	RRKPLPPSD....NNEMLQAphFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.44|      10|     132|     267|     278|       3
---------------------------------------------------------------------------
  267-  278 (14.75/15.71)	GLarDSPEDMSS
  402-  411 (17.70/10.39)	GL..DSDEELSS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10534 with Med13 domain of Kingdom Metazoa
Unable to open file!