Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MNEPTTSSGPFQIGNNATLQNMKDQGFYTLKPFLPQYSEIQGNHDLLTAHGLGPVEGNFSGSRRVKEKLSSFLPHIIGEFHLDATKETSSLRALIEKPPIHKELSTLSSSAMQGFKLSAGPVDERYRHLFERRREDGMLAHSEKLNLIRVRQNYDPYELDDDETERQFPRKHKKKKKDKKRKKDKEGSSDFSSDKKKRVDEQMEF |
Length | 205 |
Position | Head |
Organism | Caenorhabditis tropicalis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.08 |
Grand average of hydropathy | -1.088 |
Instability index | 45.89 |
Isoelectric point | 9.22 |
Molecular weight | 23651.35 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10521 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 130.03| 33| 33| 65| 97| 2 --------------------------------------------------------------------------- 30- 62 (30.18/15.11) ....LKPFLPQyseIQGNHDLLTAHGLGPVEGnFSGS 65- 97 (50.18/28.93) VKEKLSSFLPH...IIGEFHLDATKETSSLRA.LIEK 100- 132 (49.66/28.57) IHKELSTLSSS...AMQGFKLSAGPVDERYRH.LFER --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FYTLKPFL 2) RQFPRKHKKKKKDKKRKKDKEGSSDFSSDKKKRVDEQMEF | 27 166 | 34 205 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab