Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKDQGFYTLKPFLPQYSEIQGNHDLLTAHGLGPVEGNFSGSRRVKEKLSSFLPHIIGEFHLDATKETSSLRALIEKPPIHKELSTLSSSAMQGFKLSAGPVDERYRHLFERRREDGMLAHSEKLNLIRVRQNYDPYELDDDETERQFPRKHKKKKKDKKRKKDKEGSSDFSSDKKKRVDEQMEF |
Length | 184 |
Position | Head |
Organism | Caenorhabditis tropicalis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.08 |
Grand average of hydropathy | -1.117 |
Instability index | 45.53 |
Isoelectric point | 9.33 |
Molecular weight | 21448.00 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10520 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 130.03| 33| 33| 44| 76| 1 --------------------------------------------------------------------------- 9- 41 (30.18/14.59) ....LKPFLPQyseIQGNHDLLTAHGLGPVEGnFSGS 44- 76 (50.18/27.92) VKEKLSSFLPH...IIGEFHLDATKETSSLRA.LIEK 79- 111 (49.66/27.57) IHKELSTLSSS...AMQGFKLSAGPVDERYRH.LFER --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ETERQFPRKHKKKKKDKKRKKDKEGSSDFSSDKKKRVDEQMEF 2) FYTLKPFLPQY | 142 6 | 184 16 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab