Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDPNSPIFQQAVSQQRSQDSNDRNEREKSKRREKELDEAKKQEEEKMILLEKKLEEFQENARFIGDLASNFQTKHQDALNGRIYTLIRGLQDLDRIKSQFADQKVPLELLPYLDDGKNPLLYSKHCMEKTLEKNKAVNGKIEIYKKFRAHLMKEFSEEMPDLVMHYRQLRPDCDLS |
Length | 176 |
Position | Middle |
Organism | Caenorhabditis tropicalis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.07 |
Grand average of hydropathy | -1.068 |
Instability index | 58.38 |
Isoelectric point | 6.46 |
Molecular weight | 20873.49 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10513 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 160.84| 52| 56| 31| 83| 1 --------------------------------------------------------------------------- 31- 83 (79.49/45.36) RREKELDEAKKQEEEKMILLE..KKLEEfQENARFIGDLASNFQTKHQDALNGRI 88- 141 (81.35/42.47) RGLQDLDRIKSQFADQKVPLEllPYLDD.GKNPLLYSKHCMEKTLEKNKAVNGKI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MDPNSPIFQQAVSQ 2) RIYTLI | 1 82 | 14 87 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab