| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDPNSPIFQQAVSQQRSQDSNDRNEREKSKRREKELDEAKKQEEEKMILLEKKLEEFQENARFIGDLASNFQTKHQDALNGRIYTLIRGLQDLDRIKSQFADQKVPLELLPYLDDGKNPLLYSKHCMEKTLEKNKAVNGKIEIYKKFRAHLMKEFSEEMPDLVMHYRQLRPDCDLS |
| Length | 176 |
| Position | Middle |
| Organism | Caenorhabditis tropicalis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -1.068 |
| Instability index | 58.38 |
| Isoelectric point | 6.46 |
| Molecular weight | 20873.49 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP10513
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 160.84| 52| 56| 31| 83| 1
---------------------------------------------------------------------------
31- 83 (79.49/45.36) RREKELDEAKKQEEEKMILLE..KKLEEfQENARFIGDLASNFQTKHQDALNGRI
88- 141 (81.35/42.47) RGLQDLDRIKSQFADQKVPLEllPYLDD.GKNPLLYSKHCMEKTLEKNKAVNGKI
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) MDPNSPIFQQAVSQ 2) RIYTLI | 1 82 | 14 87 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab