<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10511
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MDGFPPPIPPVTANYQSEPEKINQATDMMIKRVTDAKKMIEELLQMLDMQEKCPWPDMLEKFSSLASAMSGLQSSVRKSGLPHGHEDYGQFLRSHVLVPQRLQYENDEVLQRATQGRVFSWNHALVPEYLRTKPNPEMDNEESMLDGERSAKAADLVVRQIAAYNKNIEGLLNNLTTIDRLHTEAVTEKPTHNRDETTKLVKSILTGEAIRTVRATQPPPSSTPMMQMPGSSGAMSSQSSSQGVNSGTGMQDYQNSQLRQQLMGPGSGQAQASQSHGNYSSSFQPQYQQHQQQLHPQQNPNQMAFQE |
| Length | 307 |
| Position | Head |
| Organism | Caenorhabditis tropicalis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.810 |
| Instability index | 61.36 |
| Isoelectric point | 5.87 |
| Molecular weight | 34324.06 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10511
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.42| 19| 36| 72| 100| 1
---------------------------------------------------------------------------
72- 100 (24.48/31.27) LQSSVRKSGlphghedygqFLRSHVLVPQ
110- 128 (34.93/18.14) LQRATQGRV..........FSWNHALVPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 102.39| 29| 33| 229| 261| 3
---------------------------------------------------------------------------
229- 261 (46.01/29.77) PGSSGAMSSQssSQGVNSGTGMQDYQNSQlrQQ
265- 293 (56.38/26.31) PGSGQAQASQ..SHGNYSSSFQPQYQQHQ..QQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.07| 20| 32| 171| 190| 4
---------------------------------------------------------------------------
171- 190 (32.10/24.30) LLNNLTTIDRLHTEAVTEKP
200- 219 (31.96/24.16) LVKSILTGEAIRTVRATQPP
---------------------------------------------------------------------------
|