<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10501
Description |
Uncharacterized protein |
Sequence | MKRTQQTSSRSVTTKKLIVSDYRRSLKNNIRSLSDNLTHILHASKVPLEESASKPSSSGLMADHFTLGNEVVSRTALMARAADELLKLTNSIREFLILRDFNFISQATETTQENAKTELDAMFEDYDKFRLELANVSADIDAELSDNFGLKG |
Length | 152 |
Position | Head |
Organism | Bursaphelenchus xylophilus (Pinewood nematode worm) (Aphelenchoides xylophilus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Tylenchomorpha> Aphelenchoidea> Aphelenchoididae>
Bursaphelenchus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.439 |
Instability index | 42.60 |
Isoelectric point | 5.93 |
Molecular weight | 17043.99 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10501
No repeats found
|