<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10493
Description |
Uncharacterized protein |
Sequence | MSNTGCMIDAGFREELNRTRDKVEEEFTFENSKVGRGTYGHVYKATSNKPGKETKMYFALKLIEGVGFSMSACREISLLRELNHPNLIKLQRVYLTPERKVWLLFDYAEHDLWHIIKTHRSSKTNKKQIIVAKSMVKSLMYQILDGIHYLHSNWILHRDLKPANILVMGEGTGLERGRVKIADMGFARVFYNPLKPLADLDPVVVTFWYRAPELLLCAKHYTKGIDIWAIGCIFAELLMSEPMFMCREEDIKASSPYHPDQLNKIFTVMGYPTEADWPDLKKMPEYLKLQAEFKRSK |
Length | 297 |
Position | Kinase |
Organism | Bursaphelenchus xylophilus (Pinewood nematode worm) (Aphelenchoides xylophilus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Tylenchomorpha> Aphelenchoidea> Aphelenchoididae>
Bursaphelenchus.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.317 |
Instability index | 45.87 |
Isoelectric point | 8.99 |
Molecular weight | 34473.84 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP10493
No repeats found
|