<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10491
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MEYSSAAKVSPGRLKLSLKKVITPFYGMKKEIPQQQAVIGSEDLISYYDLSSAFQRFCGPRKPKEDLSAFLTNVAATSNLKKQQDASCSLKHLVEKPPITGKDVLPLSSSAMVGFKMAAGPVPEQYQFFDSIPSDSALVNGMKERNSGNGEVELDENGRKRIKRSLDDYEEPAEKKSKKHRSGEEKEKKQKKKKKDKKKKKNDEEAGSSSKRVRAQDAYY |
| Length | 220 |
| Position | Head |
| Organism | Bursaphelenchus xylophilus (Pinewood nematode worm) (Aphelenchoides xylophilus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Tylenchomorpha> Aphelenchoidea> Aphelenchoididae>
Bursaphelenchus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.981 |
| Instability index | 47.92 |
| Isoelectric point | 9.56 |
| Molecular weight | 24643.80 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10491
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.75| 30| 32| 147| 178| 1
---------------------------------------------------------------------------
147- 178 (40.59/20.15) SGNgEVELDENGRKRIKRSLDDYEEpAEKKSK
182- 211 (48.17/17.32) SGE.EKEKKQKKKKKDKKKKKNDEE.AGSSSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.58| 13| 24| 103| 116| 2
---------------------------------------------------------------------------
103- 116 (20.36/16.15) DVLPlSSSAMV.GFK
130- 143 (20.22/11.10) DSIP.SDSALVnGMK
---------------------------------------------------------------------------
|